Lineage for d5hnna1 (5hnn A:2-315)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833324Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2833336Domain d5hnna1: 5hnn A:2-315 [328911]
    Other proteins in same PDB: d5hnna2, d5hnnc2
    automated match to d1gzja_
    complexed with gol; mutant

Details for d5hnna1

PDB Entry: 5hnn (more details), 1.63 Å

PDB Description: crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d5hnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hnna1 c.1.8.0 (A:2-315) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlalef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrstsy
gvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskyarra

SCOPe Domain Coordinates for d5hnna1:

Click to download the PDB-style file with coordinates for d5hnna1.
(The format of our PDB-style files is described here.)

Timeline for d5hnna1: