| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
| Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
| Protein automated matches [226872] (13 species) not a true protein |
| Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries) |
| Domain d5j58b2: 5j58 B:607-767 [328906] Other proteins in same PDB: d5j58a1, d5j58b1, d5j58b3 automated match to d4eg8b2 protein/RNA complex; complexed with dms, gol, met, n56 |
PDB Entry: 5j58 (more details), 2.8 Å
SCOPe Domain Sequences for d5j58b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j58b2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d5j58b2: