SCOPe 2.06: Domain d5hpca1: 5hpc A:2-316

Lineage for d5hpca1 (5hpc A:2-316)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)

8. Domain d5hpca1: 5hpc A:2-316 [328901]
   Other proteins in same PDB: d5hpca2
   automated match to d1gzja_

Details for d5hpca1

PDB Entry: 5hpc, 2.6 Å

PDB Description: structure of xaccel5a crystallized in the space group p41212

PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d5hpca1:

Sequence; same for both SEQRES and ATOM records:

>d5hpca1 c.1.8.0 (A:2-316) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlapef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrstsy
gvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskyarrag

Timeline for d5hpca1:

• d5hpca1 is new in SCOPe 2.06-stable
  
• d5hpca1 appears in SCOPe 2.07
  
• d5hpca1 appears in the current release, SCOPe 2.08