Lineage for d5hqlb1 (5hql B:1-138)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) 
C-terminal domain is beta/alpha barrel
Family d.58.9.0: automated matches [227234] (1 protein)
not a true familyProtein automated matches [226983] (27 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:1] [328882] (1 PDB entry) 
Domain d5hqlb1: 5hql B:1-138 [328899]
Other proteins in same PDB: d5hqla2, d5hqlb2, d5hqlc2, d5hqld2, d5hqle2, d5hqlf2
automated match to d4lf2a1
complexed with cap, mg; mutant
Details for d5hqlb1
PDB Entry: 5hql (more details), 2.53 Å
PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant; cabp-bound; no expression tag)
PDB Compounds: (B:) Ribulose bisphosphate carboxylaseSCOPe Domain Sequences for d5hqlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hqlb1 d.58.9.0 (B:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd
SCOPe Domain Coordinates for d5hqlb1:
Click to download the PDB-style file with coordinates for d5hqlb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hqlb1:
View in 3D
