Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein automated matches [226984] (16 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1] [328884] (1 PDB entry) |
Domain d5hqld2: 5hql D:139-455 [328897] Other proteins in same PDB: d5hqla1, d5hqlb1, d5hqlc1, d5hqld1, d5hqle1, d5hqlf1 automated match to d4lf2a2 complexed with cap, mg; mutant |
PDB Entry: 5hql (more details), 2.53 Å
SCOPe Domain Sequences for d5hqld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hqld2 c.1.14.1 (D:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 1]} gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf esfpqdadklypnwrak
Timeline for d5hqld2: