SCOPe 2.06: Domain d5fuca1: 5fuc A:21-184

Lineage for d5fuca1 (5fuc A:21-184)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein automated matches [190263] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries)

8. Domain d5fuca1: 5fuc A:21-184 [328868]
   Other proteins in same PDB: d5fuca2, d5fucc1, d5fucc2, d5fucd1, d5fucd2, d5fuce_, d5fucv_
   automated match to d4cnic_
   complexed with nag

Details for d5fuca1

PDB Entry: 5fuc, 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies

PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d5fuca1:

Sequence, based on SEQRES records:

>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne
etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpd
pttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records):

>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseridkqiryildgisalrketcnksnmcenlpkmaekdgcfqsgfneetclvkiitgl
lefevyleylqnrfesseeqaravqmstkvliqflqkkadaittpdpttnaslltklqaq
nqwlqdmtthlilrsfkeflqsslralrqm

Timeline for d5fuca1:

• d5fuca1 is new in SCOPe 2.06-stable
  
• d5fuca1 appears in SCOPe 2.07
  
• d5fuca1 appears in the current release, SCOPe 2.08