Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein automated matches [190263] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries) |
Domain d5fuca1: 5fuc A:21-184 [328868] Other proteins in same PDB: d5fuca2, d5fucc1, d5fucc2, d5fucd1, d5fucd2, d5fuce_, d5fucv_ automated match to d4cnic_ complexed with nag |
PDB Entry: 5fuc (more details), 2.7 Å
SCOPe Domain Sequences for d5fuca1:
Sequence, based on SEQRES records: (download)
>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]} sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpd pttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]} sseridkqiryildgisalrketcnksnmcenlpkmaekdgcfqsgfneetclvkiitgl lefevyleylqnrfesseeqaravqmstkvliqflqkkadaittpdpttnaslltklqaq nqwlqdmtthlilrsfkeflqsslralrqm
Timeline for d5fuca1: