Lineage for d5fuca1 (5fuc A:21-184)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705528Protein automated matches [190263] (1 species)
    not a true protein
  7. 2705529Species Human (Homo sapiens) [TaxId:9606] [187052] (14 PDB entries)
  8. 2705542Domain d5fuca1: 5fuc A:21-184 [328868]
    Other proteins in same PDB: d5fuca2, d5fucc1, d5fucc2, d5fucd1, d5fucd2, d5fuce_, d5fucv_
    automated match to d4cnic_
    complexed with nag

Details for d5fuca1

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d5fuca1:

Sequence, based on SEQRES records: (download)

>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne
etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpd
pttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseridkqiryildgisalrketcnksnmcenlpkmaekdgcfqsgfneetclvkiitgl
lefevyleylqnrfesseeqaravqmstkvliqflqkkadaittpdpttnaslltklqaq
nqwlqdmtthlilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d5fuca1:

Click to download the PDB-style file with coordinates for d5fuca1.
(The format of our PDB-style files is described here.)

Timeline for d5fuca1: