Lineage for d1baya2 (1bay A:1-78)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71105Species Mouse (Mus musculus), class pi [TaxId:10090] [52866] (6 PDB entries)
  8. 71110Domain d1baya2: 1bay A:1-78 [32886]
    Other proteins in same PDB: d1baya1, d1bayb1

Details for d1baya2

PDB Entry: 1bay (more details), 2 Å

PDB Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme

SCOP Domain Sequences for d1baya2:

Sequence, based on SEQRES records: (download)

>d1baya2 c.47.1.5 (A:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqglkptclygqlpkfedgdlt
lyqsnailrhlgrslgl

Sequence, based on observed residues (ATOM records): (download)

>d1baya2 c.47.1.5 (A:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtqlpkfedgdltlyqsnailrhlgrsl
gl

SCOP Domain Coordinates for d1baya2:

Click to download the PDB-style file with coordinates for d1baya2.
(The format of our PDB-style files is described here.)

Timeline for d1baya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1baya1