Lineage for d5hjea2 (5hje A:335-531)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865566Species Scheffersomyces stipitis [TaxId:322104] [328848] (25 PDB entries)
  8. 2865610Domain d5hjea2: 5hje A:335-531 [328850]
    Other proteins in same PDB: d5hjea3
    automated match to d1gpua2
    complexed with ca, i22, tpp

Details for d5hjea2

PDB Entry: 5hje (more details), 1.4 Å

PDB Description: crystal structure of transketolase complex with sedoheptulose-7- phoaphate from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5hjea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjea2 c.36.1.0 (A:335-531) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
lpenwdkalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdf
qpaatglgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsa
lsefpitwvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaies
thtphilaltrqnlpql

SCOPe Domain Coordinates for d5hjea2:

Click to download the PDB-style file with coordinates for d5hjea2.
(The format of our PDB-style files is described here.)

Timeline for d5hjea2: