SCOPe 2.07: Domain d5hjfa_: 5hjf A:

Lineage for d5hjfa_ (5hjf A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (44 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)

8. Domain d5hjfa_: 5hjf A: [328846]
   Other proteins in same PDB: d5hjfd2
   automated match to d4cyba_

Details for d5hjfa_

PDB Entry: 5hjf, 1.59 Å

PDB Description: the apo form of dps4 from nostoc punctiforme

PDB Compounds: (A:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5hjfa_:

Sequence; same for both SEQRES and ATOM records:

>d5hjfa_ a.25.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tqtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslh
effnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendla
aeqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

Timeline for d5hjfa_:

• d5hjfa_ first appeared in SCOPe 2.06