Lineage for d5fyxa_ (5fyx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711239Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (6 PDB entries)
  8. 2711243Domain d5fyxa_: 5fyx A: [328843]
    automated match to d2lcpa_
    complexed with ca, fd6, mpd

Details for d5fyxa_

PDB Entry: 5fyx (more details), 1.8 Å

PDB Description: crystal structure of drosophila ncs-1 bound to penothiazine fd16
PDB Compounds: (A:) frequenin 2

SCOPe Domain Sequences for d5fyxa_:

Sequence, based on SEQRES records: (download)

>d5fyxa_ a.39.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas
lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd
aiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqalslg

Sequence, based on observed residues (ATOM records): (download)

>d5fyxa_ a.39.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas
lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd
aiyqmvtpqkrvdkifdqmdknhddrltleefregskadprmvqalslg

SCOPe Domain Coordinates for d5fyxa_:

Click to download the PDB-style file with coordinates for d5fyxa_.
(The format of our PDB-style files is described here.)

Timeline for d5fyxa_: