SCOPe 2.08: Domain d5hjfd1: 5hjf D:1-182

Lineage for d5hjfd1 (5hjf D:1-182)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)

8. Domain d5hjfd1: 5hjf D:1-182 [328842]
   Other proteins in same PDB: d5hjfd2
   automated match to d4cyba_

Details for d5hjfd1

PDB Entry: 5hjf, 1.59 Å

PDB Description: the apo form of dps4 from nostoc punctiforme

PDB Compounds: (D:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5hjfd1:

Sequence; same for both SEQRES and ATOM records:

>d5hjfd1 a.25.1.0 (D:1-182) automated matches {Nostoc punctiforme [TaxId: 272131]}
maetqtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefy
slheffnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmven
dlaaeqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvq
aa

Timeline for d5hjfd1:

• d5hjfd1 first appeared in SCOPe 2.06
  
• d5hjfd1 appears in SCOPe 2.07