SCOPe 2.06: Domain d1glpa2: 1glp A:1-78

Lineage for d1glpa2 (1glp A:1-78)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)

8. Domain d1glpa2: 1glp A:1-78 [32884]
   Other proteins in same PDB: d1glpa1, d1glpb1
   complexed with gts

Details for d1glpa2

PDB Entry: 1glp, 1.9 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

PDB Compounds: (A:) glutathione s-transferase yfyf

SCOPe Domain Sequences for d1glpa2:

Sequence; same for both SEQRES and ATOM records:

>d1glpa2 c.47.1.5 (A:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Timeline for d1glpa2:

• d1glpa2 first appeared (with stable ids) in SCOP 1.55
  
• d1glpa2 appears in SCOPe 2.05
  
• d1glpa2 appears in SCOPe 2.07
  
• d1glpa2 appears in the current release, SCOPe 2.08