Lineage for d5ezil2 (5ezi L:132-238)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2749950Domain d5ezil2: 5ezi L:132-238 [328835]
    Other proteins in same PDB: d5ezih_, d5ezil1
    automated match to d1tqbc2
    complexed with cl

Details for d5ezil2

PDB Entry: 5ezi (more details), 1.61 Å

PDB Description: crystal structure of fab of parasite invasion inhibitory antibody c1 - hexagonal form
PDB Compounds: (L:) Fab c12 Light chain

SCOPe Domain Sequences for d5ezil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezil2 b.1.1.2 (L:132-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5ezil2:

Click to download the PDB-style file with coordinates for d5ezil2.
(The format of our PDB-style files is described here.)

Timeline for d5ezil2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ezil1
View in 3D
Domains from other chains:
(mouse over for more information)
d5ezih_