Lineage for d5ezil1 (5ezi L:25-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754479Domain d5ezil1: 5ezi L:25-131 [328834]
    Other proteins in same PDB: d5ezih_, d5ezil2
    automated match to d1a5fl1
    complexed with cl

Details for d5ezil1

PDB Entry: 5ezi (more details), 1.61 Å

PDB Description: crystal structure of fab of parasite invasion inhibitory antibody c1 - hexagonal form
PDB Compounds: (L:) Fab c12 Light chain

SCOPe Domain Sequences for d5ezil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezil1 b.1.1.0 (L:25-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sivmtqtpkfllvsagdrititckasqsvrndvawyqqkpgqspklliyfasnrytgvpd
rftgsgsgtdftftistvqaedlavyfcqqgytsprtfgggtkleik

SCOPe Domain Coordinates for d5ezil1:

Click to download the PDB-style file with coordinates for d5ezil1.
(The format of our PDB-style files is described here.)

Timeline for d5ezil1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ezil2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ezih_