Lineage for d1glqa2 (1glq A:1-78)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486885Protein Class pi GST [81358] (3 species)
  7. 486970Species Mouse (Mus musculus) [TaxId:10090] [52866] (6 PDB entries)
  8. 486971Domain d1glqa2: 1glq A:1-78 [32882]
    Other proteins in same PDB: d1glqa1, d1glqb1

Details for d1glqa2

PDB Entry: 1glq (more details), 1.8 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glqa2 c.47.1.5 (A:1-78) Class pi GST {Mouse (Mus musculus)}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOP Domain Coordinates for d1glqa2:

Click to download the PDB-style file with coordinates for d1glqa2.
(The format of our PDB-style files is described here.)

Timeline for d1glqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glqa1