SCOPe 2.07: Domain d5aoha_: 5aoh A:

Lineage for d5aoha_ (5aoh A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Serratia sp. [TaxId:104623] [328815] (1 PDB entry)

8. Domain d5aoha_: 5aoh A: [328816]
   automated match to d2q17e_
   complexed with k

Details for d5aoha_

PDB Entry: 5aoh, 1.8 Å

PDB Description: crystal structure of carf

PDB Compounds: (A:) carf

SCOPe Domain Sequences for d5aoha_:

Sequence; same for both SEQRES and ATOM records:

>d5aoha_ d.169.1.0 (A:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanl
pvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgs
lascdvhtpgfamsdigfrlvrpid

Timeline for d5aoha_:

• d5aoha_ first appeared in SCOPe 2.06