| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [52865] (1 PDB entry) |
| Domain d2gsrb2: 2gsr B:1-76 [32881] Other proteins in same PDB: d2gsra1, d2gsrb1 complexed with gts |
PDB Entry: 2gsr (more details), 2.11 Å
SCOPe Domain Sequences for d2gsrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsrb2 c.47.1.5 (B:1-76) Class pi GST {Pig (Sus scrofa) [TaxId: 9823]}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl
Timeline for d2gsrb2: