![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
![]() | Protein automated matches [229097] (6 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries) |
![]() | Domain d5tpba1: 5tpb A:876-1079 [328799] Other proteins in same PDB: d5tpba2, d5tpba3, d5tpba4, d5tpbb2, d5tpbb3 automated match to d2vuaa1 complexed with sia |
PDB Entry: 5tpb (more details), 2.6 Å
SCOPe Domain Sequences for d5tpba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tpba1 b.29.1.6 (A:876-1079) automated matches {Clostridium botulinum [TaxId: 1491]} tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf kldgcrdthryiwikyfnlfdkel
Timeline for d5tpba1: