SCOPe 2.06: Domain d5hh6a_: 5hh6 A:

Lineage for d5hh6a_ (5hh6 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (7 PDB entries)

8. Domain d5hh6a_: 5hh6 A: [328793]
   automated match to d2fu9a_
   complexed with 60n, so4, zn

Details for d5hh6a_

PDB Entry: 5hh6, 1.8 Å

PDB Description: crystal structure of b3 metallo-beta-lactamase l1 in complex with a phosphonate-based inhibitor

PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d5hh6a_:

Sequence; same for both SEQRES and ATOM records:

>d5hh6a_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

Timeline for d5hh6a_:

• d5hh6a_ is new in SCOPe 2.06-stable
  
• d5hh6a_ appears in SCOPe 2.07
  
• d5hh6a_ appears in the current release, SCOPe 2.08