| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
| Family b.34.6.0: automated matches [328522] (1 protein) not a true family |
| Protein automated matches [328523] (5 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [328524] (7 PDB entries) |
| Domain d5hjza_: 5hjz A: [328790] Other proteins in same PDB: d5hjzb2 automated match to d4of1a_ protein/RNA complex |
PDB Entry: 5hjz (more details), 1.98 Å
SCOPe Domain Sequences for d5hjza_:
Sequence, based on SEQRES records: (download)
>d5hjza_ b.34.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mrrgeiwqvdldpargseannqrpavvvsndranatatrlgrgvitvvpvtsniakvypf
qvllsatttglqvdckaqaeqirsiaterllrpigrvsaaelaqldealklhldl
>d5hjza_ b.34.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mrrgeiwqvdldpargseannqrpavvvsndranatatrlgrgvitvvpvtsniakvypf
qvllsattglqvdckaqaeqirsiaterllrpigrvsaaelaqldealklhldl
Timeline for d5hjza_: