Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Vibrio fischeri [TaxId:312309] [328771] (1 PDB entry) |
Domain d5ue1b1: 5ue1 B:1-231 [328787] Other proteins in same PDB: d5ue1a2, d5ue1b2 automated match to d3dp9c_ complexed with 9da, ca, cl, edo, trs |
PDB Entry: 5ue1 (more details), 1.14 Å
SCOPe Domain Sequences for d5ue1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue1b1 c.56.2.1 (B:1-231) automated matches {Vibrio fischeri [TaxId: 312309]} mkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaavgtt lliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpaafi adeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeasaia qtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk
Timeline for d5ue1b1: