Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class pi GST [81358] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries) |
Domain d1gssa2: 1gss A:1-76 [32878] Other proteins in same PDB: d1gssa1, d1gssb1 complexed with lee |
PDB Entry: 1gss (more details), 2.8 Å
SCOPe Domain Sequences for d1gssa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gssa2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl tlyqsntilrhlgrtlgl
Timeline for d1gssa2: