Lineage for d5u9da_ (5u9d A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220941Protein automated matches [190091] (17 species)
    not a true protein
  7. 2221040Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)
  8. 2221075Domain d5u9da_: 5u9d A: [328777]
    automated match to d4z3va_
    complexed with 83p, edo, peg

Details for d5u9da_

PDB Entry: 5u9d (more details), 1.33 Å

PDB Description: discovery of a potent btk inhibitor with a novel binding mode using parallel selections with a dna-encoded chemical library
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5u9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u9da_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
imyscwhekaderptfkillsnildvmdees

SCOPe Domain Coordinates for d5u9da_:

Click to download the PDB-style file with coordinates for d5u9da_.
(The format of our PDB-style files is described here.)

Timeline for d5u9da_: