SCOPe 2.08: Domain d5u9da_: 5u9d A:

Lineage for d5u9da_ (5u9d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5u9da_: 5u9d A: [328777]
   automated match to d4z3va_
   complexed with 83p, edo, peg

Details for d5u9da_

PDB Entry: 5u9d, 1.33 Å

PDB Description: discovery of a potent btk inhibitor with a novel binding mode using parallel selections with a dna-encoded chemical library

PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5u9da_:

Sequence; same for both SEQRES and ATOM records:

>d5u9da_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
imyscwhekaderptfkillsnildvmdees

Timeline for d5u9da_:

• d5u9da_ first appeared in SCOPe 2.06
  
• d5u9da_ appears in SCOPe 2.07