Lineage for d5hk3b_ (5hk3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784382Family b.34.6.0: automated matches [328522] (1 protein)
    not a true family
  6. 2784383Protein automated matches [328523] (5 species)
    not a true protein
  7. 2784412Species Mycobacterium tuberculosis [TaxId:83332] [328524] (7 PDB entries)
  8. 2784414Domain d5hk3b_: 5hk3 B: [328766]
    automated match to d4of1a_
    protein/DNA complex; mutant

Details for d5hk3b_

PDB Entry: 5hk3 (more details), 1.56 Å

PDB Description: crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
PDB Compounds: (B:) Endoribonuclease MazF6

SCOPe Domain Sequences for d5hk3b_:

Sequence, based on SEQRES records: (download)

>d5hk3b_ b.34.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
visraeiywadlgppsgsqpakrrpvlviqsdpynasrlatviaavitsndalaampgnv
dlpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

Sequence, based on observed residues (ATOM records): (download)

>d5hk3b_ b.34.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
visraeiywadlrrpvlviqsdpynasrlatviaavitsndalaampgnvdlpatttrlp
rdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

SCOPe Domain Coordinates for d5hk3b_:

Click to download the PDB-style file with coordinates for d5hk3b_.
(The format of our PDB-style files is described here.)

Timeline for d5hk3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hk3a_