| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
| Protein automated matches [229097] (6 species) not a true protein |
| Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries) |
| Domain d5tpbb1: 5tpb B:877-1079 [328763] Other proteins in same PDB: d5tpba2, d5tpba3, d5tpba4, d5tpbb2, d5tpbb3 automated match to d2vuaa1 complexed with sia |
PDB Entry: 5tpb (more details), 2.6 Å
SCOPe Domain Sequences for d5tpbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tpbb1 b.29.1.6 (B:877-1079) automated matches {Clostridium botulinum [TaxId: 1491]}
silnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyns
myenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikqr
vvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimfk
ldgcrdthryiwikyfnlfdkel
Timeline for d5tpbb1:
View in 3DDomains from other chains: (mouse over for more information) d5tpba1, d5tpba2, d5tpba3, d5tpba4 |