![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Enterobacter cloacae [TaxId:550] [328722] (1 PDB entry) |
![]() | Domain d5u8jb2: 5u8j B:85-173 [328759] automated match to d3bz6a2 complexed with cl |
PDB Entry: 5u8j (more details), 2.52 Å
SCOPe Domain Sequences for d5u8jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u8jb2 a.4.5.0 (B:85-173) automated matches {Enterobacter cloacae [TaxId: 550]} fcnsefgdlklsaaevavittlllrgaqtpgelrtrasrmhefadmqeveqtldglatre dgpyvvrlarepgkresrymhlfsgevdt
Timeline for d5u8jb2: