Lineage for d5u8jd1 (5u8j D:1-84)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694692Species Enterobacter cloacae [TaxId:550] [328722] (1 PDB entry)
  8. 2694699Domain d5u8jd1: 5u8j D:1-84 [328751]
    automated match to d3bz6a1
    complexed with cl

Details for d5u8jd1

PDB Entry: 5u8j (more details), 2.52 Å

PDB Description: crystal structure of a protein of unknown function ecl_02571 involved in membrane biogenesis from enterobacter cloacae
PDB Compounds: (D:) UPF0502 protein BFJ73_07745

SCOPe Domain Sequences for d5u8jd1:

Sequence, based on SEQRES records: (download)

>d5u8jd1 a.4.5.0 (D:1-84) automated matches {Enterobacter cloacae [TaxId: 550]}
mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
elvkrhylrtvsgfgnrvtkyeqr

Sequence, based on observed residues (ATOM records): (download)

>d5u8jd1 a.4.5.0 (D:1-84) automated matches {Enterobacter cloacae [TaxId: 550]}
mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
elvkrhylrtvsvtkyeqr

SCOPe Domain Coordinates for d5u8jd1:

Click to download the PDB-style file with coordinates for d5u8jd1.
(The format of our PDB-style files is described here.)

Timeline for d5u8jd1: