SCOPe 2.06: Domain d5ucca_: 5ucc A:

Lineage for d5ucca_ (5ucc A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (5 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [328736] (1 PDB entry)

8. Domain d5ucca_: 5ucc A: [328737]
   automated match to d1h0aa_
   complexed with cit, cl

Details for d5ucca_

PDB Entry: 5ucc, 1.83 Å

PDB Description: crystal structure of the enth domain of ent2 from candida albicans

PDB Compounds: (A:) Potential epsin-like clathrin-binding protein

SCOPe Domain Sequences for d5ucca_:

Sequence; same for both SEQRES and ATOM records:

>d5ucca_ a.118.9.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
yssaqrvvrnatsndptgpttfdmeeissftyqsqtefmevmdmldrrlndkgknwrhva
ksltvldylvrygsdkcvlwakdnlyiiktlrefvhfdetnndqgaiirvkakelvsllr
dderlkqeranakkn

Timeline for d5ucca_:

• d5ucca_ is new in SCOPe 2.06-stable
  
• d5ucca_ appears in SCOPe 2.07
  
• d5ucca_ appears in the current release, SCOPe 2.08