Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) |
Family a.118.9.0: automated matches [191620] (1 protein) not a true family |
Protein automated matches [191137] (5 species) not a true protein |
Species Candida albicans [TaxId:237561] [328736] (1 PDB entry) |
Domain d5ucca_: 5ucc A: [328737] automated match to d1h0aa_ complexed with cit, cl |
PDB Entry: 5ucc (more details), 1.83 Å
SCOPe Domain Sequences for d5ucca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ucca_ a.118.9.0 (A:) automated matches {Candida albicans [TaxId: 237561]} yssaqrvvrnatsndptgpttfdmeeissftyqsqtefmevmdmldrrlndkgknwrhva ksltvldylvrygsdkcvlwakdnlyiiktlrefvhfdetnndqgaiirvkakelvsllr dderlkqeranakkn
Timeline for d5ucca_: