Lineage for d5ucca_ (5ucc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727164Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2727165Protein automated matches [191137] (5 species)
    not a true protein
  7. 2727174Species Candida albicans [TaxId:237561] [328736] (1 PDB entry)
  8. 2727175Domain d5ucca_: 5ucc A: [328737]
    automated match to d1h0aa_
    complexed with cit, cl

Details for d5ucca_

PDB Entry: 5ucc (more details), 1.83 Å

PDB Description: crystal structure of the enth domain of ent2 from candida albicans
PDB Compounds: (A:) Potential epsin-like clathrin-binding protein

SCOPe Domain Sequences for d5ucca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucca_ a.118.9.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
yssaqrvvrnatsndptgpttfdmeeissftyqsqtefmevmdmldrrlndkgknwrhva
ksltvldylvrygsdkcvlwakdnlyiiktlrefvhfdetnndqgaiirvkakelvsllr
dderlkqeranakkn

SCOPe Domain Coordinates for d5ucca_:

Click to download the PDB-style file with coordinates for d5ucca_.
(The format of our PDB-style files is described here.)

Timeline for d5ucca_: