Lineage for d1eohe2 (1eoh E:1-76)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584951Protein Class pi GST [81358] (4 species)
  7. 584952Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 585026Domain d1eohe2: 1eoh E:1-76 [32872]
    Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1

Details for d1eohe2

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eohe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohe2 c.47.1.5 (E:1-76) Class pi GST {Human (Homo sapiens)}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOP Domain Coordinates for d1eohe2:

Click to download the PDB-style file with coordinates for d1eohe2.
(The format of our PDB-style files is described here.)

Timeline for d1eohe2:

585026
d1eohe2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1eohe1