Lineage for d5tpca1 (5tpc A:876-1079)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779869Protein automated matches [229097] (6 species)
    not a true protein
  7. 2779870Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries)
  8. 2779877Domain d5tpca1: 5tpc A:876-1079 [328718]
    Other proteins in same PDB: d5tpca2, d5tpca3, d5tpca4
    automated match to d2vuaa1

Details for d5tpca1

PDB Entry: 5tpc (more details), 2 Å

PDB Description: binding domain of bont/a complexed with ganglioside
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5tpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpca1 b.29.1.6 (A:876-1079) automated matches {Clostridium botulinum [TaxId: 1491]}
tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
kldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d5tpca1:

Click to download the PDB-style file with coordinates for d5tpca1.
(The format of our PDB-style files is described here.)

Timeline for d5tpca1: