Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins) Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer |
Protein YwfI homologue [110966] (3 species) |
Species Geobacillus stearothermophilus [TaxId:272567] [328691] (1 PDB entry) |
Domain d5t2kc_: 5t2k C: [328700] automated match to d1t0tv_ complexed with 76r |
PDB Entry: 5t2k (more details), 1.8 Å
SCOPe Domain Sequences for d5t2kc_:
Sequence, based on SEQRES records: (download)
>d5t2kc_ d.58.4.10 (C:) YwfI homologue {Geobacillus stearothermophilus [TaxId: 272567]} seaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavy tivgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedp yqipevrrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagk vtqiitgsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmen vssffhv
>d5t2kc_ d.58.4.10 (C:) YwfI homologue {Geobacillus stearothermophilus [TaxId: 272567]} seaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavy tivgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelssedpyqipev rrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqiit gsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvssffh v
Timeline for d5t2kc_:
View in 3D Domains from other chains: (mouse over for more information) d5t2ka_, d5t2kb_, d5t2kd_, d5t2ke_ |