Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
Protein automated matches [190796] (6 species) not a true protein |
Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries) |
Domain d5ldoc_: 5ldo C: [328683] automated match to d4qakb_ complexed with 3am |
PDB Entry: 5ldo (more details), 2.75 Å
SCOPe Domain Sequences for d5ldoc_:
Sequence, based on SEQRES records: (download)
>d5ldoc_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]} epqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekalsl lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpf hphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
>d5ldoc_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]} epqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekalsl lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarpfhphitllr daseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
Timeline for d5ldoc_: