SCOPe 2.07: Domain d2naza_: 2naz A:

Lineage for d2naza_ (2naz A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (24 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [328679] (1 PDB entry)

8. Domain d2naza_: 2naz A: [328680]
   automated match to d4nhjb_

Details for d2naza_

PDB Entry: 2naz

PDB Description: the solution nmr structure of the c-terminal effector domain of bfmr from acinetobacter baumannii

PDB Compounds: (A:) Transcriptional regulatory protein RstA

SCOPe Domain Sequences for d2naza_:

Sequence; same for both SEQRES and ATOM records:

>d2naza_ a.4.6.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
edevaqriefddlvidnggrsvtlngelvdftsaeydllwllasnagrilsrediferlr
gieydgqdrsidvrisrirpkigddpenpkriktvrskgylfvketngl

Timeline for d2naza_:

• d2naza_ first appeared in SCOPe 2.06
  
• d2naza_ appears in the current release, SCOPe 2.08