SCOPe 2.08: Domain d5hh4b1: 5hh4 B:1-220

Lineage for d5hh4b1 (5hh4 B:1-220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries)

8. Domain d5hh4b1: 5hh4 B:1-220 [328677]
   Other proteins in same PDB: d5hh4b2
   automated match to d1jjeb_
   complexed with 60m, cl, edo, zn

Details for d5hh4b1

PDB Entry: 5hh4, 2 Å

PDB Description: crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor

PDB Compounds: (B:) beta-lactamase imp-1

SCOPe Domain Sequences for d5hh4b1:

Sequence; same for both SEQRES and ATOM records:

>d5hh4b1 d.157.1.1 (B:1-220) automated matches {Serratia marcescens [TaxId: 615]}
aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
kllkskygkaklvvpshsevgdasllkltleqavkglnes

Timeline for d5hh4b1:

• d5hh4b1 first appeared in SCOPe 2.06
  
• d5hh4b1 appears in SCOPe 2.07