Lineage for d5hkwa2 (5hkw A:178-263)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711389Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2711393Protein Cbl [47561] (1 species)
  7. 2711394Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries)
  8. 2711408Domain d5hkwa2: 5hkw A:178-263 [328670]
    Other proteins in same PDB: d5hkwa1, d5hkwa3, d5hkwb1, d5hkwb3, d5hkwc1, d5hkwc3
    automated match to d3buxb1
    complexed with na

Details for d5hkwa2

PDB Entry: 5hkw (more details), 2.25 Å

PDB Description: crystal structure of apo c-cbl tkbd refined to 2.25 a resolution
PDB Compounds: (A:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d5hkwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkwa2 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOPe Domain Coordinates for d5hkwa2:

Click to download the PDB-style file with coordinates for d5hkwa2.
(The format of our PDB-style files is described here.)

Timeline for d5hkwa2: