| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) ![]() automatically mapped to Pfam PF02262 |
| Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) |
| Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries) |
| Domain d5hkwa1: 5hkw A:48-177 [328669] Other proteins in same PDB: d5hkwa2, d5hkwa3, d5hkwb2, d5hkwb3, d5hkwc2, d5hkwc3 automated match to d2cbla2 complexed with na |
PDB Entry: 5hkw (more details), 2.25 Å
SCOPe Domain Sequences for d5hkwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hkwa1 a.48.1.1 (A:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
ifpsglfqgd
Timeline for d5hkwa1: