Lineage for d5lyjf1 (5lyj F:1-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862155Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2862156Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2862157Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)
  8. 2862283Domain d5lyjf1: 5lyj F:1-76 [328659]
    Other proteins in same PDB: d5lyja1, d5lyja2, d5lyjb1, d5lyjb2, d5lyjc1, d5lyjc2, d5lyjd1, d5lyjd2, d5lyje_, d5lyjf2, d5lyjf3
    automated match to d3tiia1
    complexed with 7ba, acp, ca, gdp, gol, gtp, mes, mg

Details for d5lyjf1

PDB Entry: 5lyj (more details), 2.4 Å

PDB Description: tubulin-combretastatin a4 complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5lyjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lyjf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5lyjf1:

Click to download the PDB-style file with coordinates for d5lyjf1.
(The format of our PDB-style files is described here.)

Timeline for d5lyjf1: