Lineage for d5gzol1 (5gzo L:1-107)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5gzol1: 5gzo L:1-107 [328648]
    Other proteins in same PDB: d5gzoa1, d5gzoa2, d5gzob1, d5gzob2, d5gzoc2, d5gzoh2
    automated match to d1dqdl1

Details for d5gzol1

PDB Entry: 5gzo (more details), 2.7600000000000002 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d5gzol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzol1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslqsgvps
rfsgsgsgteftltisslqpedfatyyclqhnsyprtfgqgtkveik

SCOPe Domain Coordinates for d5gzol1 are not available.

Timeline for d5gzol1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gzol2
View in 3D
Domains from other chains:
(mouse over for more information)
d5gzoa1, d5gzoa2, d5gzob1, d5gzob2, d5gzoc1, d5gzoc2, d5gzod1, d5gzod2, d5gzoh1, d5gzoh2