Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d5hd8d2: 5hd8 D:107-211 [328646] Other proteins in same PDB: d5hd8a_, d5hd8b_, d5hd8c_, d5hd8d1, d5hd8e_, d5hd8f1 automated match to d1ikfl2 complexed with cl |
PDB Entry: 5hd8 (more details), 3.15 Å
SCOPe Domain Sequences for d5hd8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hd8d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d5hd8d2: