SCOPe 2.08: Domain d5h38b_: 5h38 B:

Lineage for d5h38b_ (5h38 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Human herpesvirus 8 [TaxId:37296] [328471] (3 PDB entries)

8. Domain d5h38b_: 5h38 B: [328641]
   automated match to d1hvya_
   complexed with po4

Details for d5h38b_

PDB Entry: 5h38, 1.7 Å

PDB Description: structural analysis of kshv thymidylate synthase

PDB Compounds: (B:) orf70

SCOPe Domain Sequences for d5h38b_:

Sequence; same for both SEQRES and ATOM records:

>d5h38b_ d.117.1.1 (B:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirme

Timeline for d5h38b_:

• d5h38b_ first appeared in SCOPe 2.06
  
• d5h38b_ appears in SCOPe 2.07