SCOPe 2.07: Domain d5mesa_: 5mes A:

Lineage for d5mesa_ (5mes A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries)

8. Domain d5mesa_: 5mes A: [328639]
   Other proteins in same PDB: d5mesl1, d5mesl2
   automated match to d2kbwa_
   complexed with 7lt

Details for d5mesa_

PDB Entry: 5mes, 2.24 Å

PDB Description: mcl1 fab complex in complex with compound 29

PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5mesa_:

Sequence; same for both SEQRES and ATOM records:

>d5mesa_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

Timeline for d5mesa_:

• d5mesa_ first appeared in SCOPe 2.06
  
• d5mesa_ appears in the current release, SCOPe 2.08