Lineage for d5lyjc2 (5lyj C:246-440)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2566285Domain d5lyjc2: 5lyj C:246-440 [328636]
    Other proteins in same PDB: d5lyja1, d5lyjb1, d5lyjc1, d5lyjd1, d5lyje_, d5lyjf1, d5lyjf2, d5lyjf3
    automated match to d4i50a2
    complexed with 7ba, acp, ca, gdp, gol, gtp, mes, mg

Details for d5lyjc2

PDB Entry: 5lyj (more details), 2.4 Å

PDB Description: tubulin-combretastatin a4 complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5lyjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lyjc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5lyjc2:

Click to download the PDB-style file with coordinates for d5lyjc2.
(The format of our PDB-style files is described here.)

Timeline for d5lyjc2: