Lineage for d5ldjc_ (5ldj C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563291Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2563292Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2563354Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2563355Protein automated matches [190796] (6 species)
    not a true protein
  7. 2563361Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries)
  8. 2563382Domain d5ldjc_: 5ldj C: [328621]
    automated match to d4qakb_
    complexed with po4

Details for d5ldjc_

PDB Entry: 5ldj (more details), 2.8 Å

PDB Description: crystal structure of e.coli ligt complexed with phosphate
PDB Compounds: (C:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5ldjc_:

Sequence, based on SEQRES records: (download)

>d5ldjc_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp
fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records): (download)

>d5ldjc_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarfhphitllr
daseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d5ldjc_:

Click to download the PDB-style file with coordinates for d5ldjc_.
(The format of our PDB-style files is described here.)

Timeline for d5ldjc_: