| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (10 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) |
| Domain d5lyjd1: 5lyj D:2-245 [328613] Other proteins in same PDB: d5lyja2, d5lyjb2, d5lyjc2, d5lyjd2, d5lyje_, d5lyjf1, d5lyjf2, d5lyjf3 automated match to d4drxb1 complexed with 7ba, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5lyj (more details), 2.4 Å
SCOPe Domain Sequences for d5lyjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lyjd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp
Timeline for d5lyjd1: