SCOPe 2.06: Domain d5lyjd1: 5lyj D:2-245

Lineage for d5lyjd1 (5lyj D:2-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)

8. Domain d5lyjd1: 5lyj D:2-245 [328613]
   Other proteins in same PDB: d5lyja2, d5lyjb2, d5lyjc2, d5lyjd2, d5lyje_, d5lyjf1, d5lyjf2, d5lyjf3
   automated match to d4drxb1
   complexed with 7ba, acp, ca, gdp, gol, gtp, mes, mg

Details for d5lyjd1

PDB Entry: 5lyj, 2.4 Å

PDB Description: tubulin-combretastatin a4 complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5lyjd1:

Sequence; same for both SEQRES and ATOM records:

>d5lyjd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5lyjd1:

• d5lyjd1 is new in SCOPe 2.06-stable
  
• d5lyjd1 appears in SCOPe 2.07
  
• d5lyjd1 appears in the current release, SCOPe 2.08