![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries) |
![]() | Domain d5lyjb2: 5lyj B:246-440 [328610] Other proteins in same PDB: d5lyja1, d5lyjb1, d5lyjc1, d5lyjd1, d5lyje_, d5lyjf1, d5lyjf2, d5lyjf3 automated match to d3rycd2 complexed with 7ba, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5lyj (more details), 2.4 Å
SCOPe Domain Sequences for d5lyjb2:
Sequence, based on SEQRES records: (download)
>d5lyjb2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdata
>d5lyjb2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd ata
Timeline for d5lyjb2: