Lineage for d5lnva_ (5lnv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827735Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (11 PDB entries)
  8. 2827776Domain d5lnva_: 5lnv A: [328597]
    automated match to d3fema_
    complexed with kik, po4, so4

Details for d5lnva_

PDB Entry: 5lnv (more details), 2.24 Å

PDB Description: crystal structure of arabidopsis thaliana pdx1-i320 complex from multiple crystals
PDB Compounds: (A:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5lnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lnva_ c.1.2.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
arraraivqavthysdpemlvevscglgeamvginln

SCOPe Domain Coordinates for d5lnva_:

Click to download the PDB-style file with coordinates for d5lnva_.
(The format of our PDB-style files is described here.)

Timeline for d5lnva_: